- Ferroportin/SLC40A1 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP2-49454
- 0.1 ml (also 25ul)
- Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- Human
- Ferroportin/SLC40A1
- IgG
- Rabbit
- This Ferroportin/SLC40A1 Antibody was developed against a recombinant protein corresponding to amino acids: VKAGLKEEET ELKQLNLHKD TEPKPLEGTH LMGVKDSNIH ELEHEQEPTC ASQMAEPFRT FRDGWVSYYN
- solute carrier family 40 member 1
- FPN, FPN1, HFE4, IREG1, MST079, MSTP079, MTP1, SLC11A3
- Polyclonal
- Immunogen affinity purified
- Novus Biologicals, a Bio-Techne Brand
- Cancer, Lipid and Metabolism, Signal Transduction
- 62.5 kDa
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
VKAGLKEEETELKQLNLHKDTEPKPLEGTHLMGVKDSNIHELEHEQEPTCASQMAEPFRTFRDGWVSYYN
Specifications/Features
Available conjugates: Unconjugated